PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678459663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRAS
Protein Properties Length: 571aa    MW: 63150 Da    PI: 5.1079
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678459663genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.65e-1311995663373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL+ecA  v+ g l +a++++  l+e++s +gdp +R+aay++eALaar+a+s+++lykal++++++   +s++l+a+++++ev+P+++f+++taN+aI
  678459663 199 SLLFECAALVHYGALDKATEMIHALRERVSIQGDPCERIAAYMVEALAARIAQSGKGLYKALKCKPQP---TSDRLSAMQVLFEVCPCFRFGFMTANSAI 295
                79*****************************************************************9...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                lea   ++++Hi+Dfdi+qG Q+ +Ll++La+  +  p++R+Tgv++pes+      l+ +g+rL+++Ae l+++fef++ va +++ +++++L+++p+E
  678459663 296 LEACRDQNKLHIVDFDINQGSQYYTLLKSLAKIHGTRPQVRLTGVDDPESVqrAVGGLRVIGQRLQQLAEDLQLSFEFHA-VAAETALVSPSMLDCRPDE 394
                *************************************************99878889***********************.7999*************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                al+Vn+++qlh+++desvs+ + rd++L++vksl+Pk+v+vveq++++n+++Fl rf+ea +yysa+f+sl+a lpr+s++r++vE+++l+r+i n++ac
  678459663 395 ALVVNFAFQLHHMPDESVSTVNLRDRLLRMVKSLKPKLVTVVEQDVNTNTAPFLSRFSEAYSYYSAVFESLDAALPRDSQDRMNVEKHCLARDIINIIAC 494
                **************************************************************************************************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                eg+er er e ++kWr+r+++aGF + p+++k+ ++++ l+++++s+ y++++e g+l +gW+d+ Lv++SaW
  678459663 495 EGEERLERYEVAGKWRARMTMAGFASFPIGSKVKSEISELIQHYSSR-YKMKDEMGALHFGWEDKFLVVASAW 566
                *********************************************88.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.199171548IPR005202Transcription factor GRAS
PfamPF035141.7E-128199566IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MSLARFAAVS GTPDVTKNGN NDSGYPNSSL NPEIHGVVYT CESYCGDDHG YTPFFGSASD  60
EPVYQNGSSL PENVLHGTDS PSSFSMARKN SSFVSSENYG FRFDIESACF NTQNPDVMEY  120
NEGGMRLKLQ ELEKALLDDN DNDMTNFYNG VEVDNEWAVT TSGALLHDSP KESSSSGSSS  180
VLSTSTAERV STTPSSPKSL LFECAALVHY GALDKATEMI HALRERVSIQ GDPCERIAAY  240
MVEALAARIA QSGKGLYKAL KCKPQPTSDR LSAMQVLFEV CPCFRFGFMT ANSAILEACR  300
DQNKLHIVDF DINQGSQYYT LLKSLAKIHG TRPQVRLTGV DDPESVQRAV GGLRVIGQRL  360
QQLAEDLQLS FEFHAVAAET ALVSPSMLDC RPDEALVVNF AFQLHHMPDE SVSTVNLRDR  420
LLRMVKSLKP KLVTVVEQDV NTNTAPFLSR FSEAYSYYSA VFESLDAALP RDSQDRMNVE  480
KHCLARDIIN IIACEGEERL ERYEVAGKWR ARMTMAGFAS FPIGSKVKSE ISELIQHYSS  540
RYKMKDEMGA LHFGWEDKFL VVASAWGASH L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-5921656622374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A068UU850.0A0A068UU85_COFCA; Uncharacterized protein
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1